<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29629
Description |
Uncharacterized protein |
Sequence | MASSMSGMFTGQQPPGAHPVGGPGGPGQPSFASAAPRTQGSNTLVDELEASFEACFASLVSQDYVNGTDQEEIRTGVDQCIQKFLDVARQTECFFLQKRLQLSVQKPEQVVKEDVSELRNELQRKEMLVQKHLTKLHHWQQVLEDVSGQHRKPSDLPPPGPLAFLEQASANLPPAPLKPN |
Length | 180 |
Position | Head |
Organism | Oreochromis niloticus (Nile tilapia) (Tilapia nilotica) |
Kingdom | Metazoa |
Lineage | |
Aromaticity | 0.06 |
Grand average of hydropathy | -0.544 |
Instability index | 50.48 |
Isoelectric point | 5.51 |
Molecular weight | 19711.00 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP29629
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 74.27| 23| 30| 90| 113| 1
---------------------------------------------------------------------------
90- 113 (34.12/23.75) QTECFFLQKRLQlSVQKPEQVVKE
123- 145 (40.15/23.83) QRKEMLVQKHLT.KLHHWQQVLED
---------------------------------------------------------------------------
|