<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29626
| Description |
Mediator of RNA polymerase II transcription subunit 15 |
| Sequence | MEMSGADSDWRSPQFRQKVVAQIEEAIRKAGTSNTTHKSGTDMENHVYVKAKSREEYLSLVARLIIHFRDIHKKALGGSDPMNALNTLTGVGGGPGAIGMGPRPAGAPVGGMGAMGPMQIGQHAMAGVAGNPQAIGGPGPMPMQHQVRPGHTPCRQSECCVXHISIDPVVQQQQQQVQAQTQPVQMPPHSQQQQQQQQQSGMVPQSLTGQIPSQHVSLNQQQQQQRLQAFQVRQSCRFGSVTATESQPDSRCISAFLHHSFTQCCHLKDWTDTLTSEKAANQIFKIKQEVCNENPTRGCDQSAVPAPVVSVLPPSACMAALQQQQQQAAQQAQQAAAQAQLNAAAAAATVPGQVRTPPQTQVHQLQSDKRQEIVEQVSEYTSLQQKQLVRPGMQIPARLPRAPLNPIPPQNATTAAAGVVGVQAMTPQMSSPSPVQVPTPQSMPPPPQPSPQPPTSQPNSASSGPTPSPGGFQPSPSPQPSPSPANSRTPQNYGVPSPGPLSTPVNPNSVMSPAGPTSLEDQQYMEKLKQLSKYIEPLRRMINKIDKNEDRKKDLSKMKSLLNILTDPSTRCPLKTLQKCEIALEKLKNDMAVPTPPPPPVATNKQYLCQPLLDAVMANIRSPVFNHSLYRSFAPAMSAIHGPPIMGPNISGRKRKHEEDERQTIPNILQGEVARLDVKFLVNLDPSYCSNNGTVHLICKLDDKNLPSVPPLQLSVPADYPDQSPHWADDGEQYGANSFLQTVHRNMTSKLLQLPDKHSVTELLNTWARSVQQACLSA |
| Length | 778 |
| Position | Tail |
| Organism | Oreochromis niloticus (Nile tilapia) (Tilapia nilotica) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Teleostei> Neoteleostei> Acanthomorphata>
Ovalentaria> Cichlomorphae> Cichliformes> Cichlidae> African cichlids>
Pseudocrenilabrinae> Oreochromini> Oreochromis.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.586 |
| Instability index | 72.80 |
| Isoelectric point | 8.94 |
| Molecular weight | 84182.64 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP29626
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
7| 246.78| 28| 28| 426| 453| 1
---------------------------------------------------------------------------
172- 190 (32.14/ 8.38) QQQQQV..........QAQ...........T..QPVQM.P.PHS
330- 358 (33.96/ 9.33) QQAQQA..........AAQ.aqLNAAAAAAT..VPGQV.R.TPP
384- 409 (35.79/10.29) QQKQLV..........RPG...MQIPA..RLP.RAPLN.P.IPP
410- 447 (42.71/13.91) QNATTAaagvvgvqamTPQ...MSSPSPVQVP.TPQSM.P.PPP
448- 478 (35.80/10.30) QPSPQP.........pTSQ...PNSASSGPTP.SPGGFqPsPSP
479- 514 (30.07/ 7.30) QPSPSP......ansrTPQnygVPSPGPLSTPvNPNSV.M.SPA
578- 600 (36.32/10.57) QKCEIA..........LEK...L..KNDMAVP.TP....P.PPP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 97.37| 19| 22| 90| 108| 2
---------------------------------------------------------------------------
90- 108 (39.92/19.10) GVGG.GPGAIGMGP..RP..AGAP
111- 132 (25.22/ 9.20) GMGAmGPMQIGQHA..MAgvAGNP
133- 153 (32.23/13.92) QAIG.GPGPMPMQHqvRP..GHTP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 83.82| 21| 28| 191| 216| 3
---------------------------------------------------------------------------
191- 206 (26.53/17.41) ........QQQQQQQQQSGMVPQS
212- 235 (35.10/12.78) PSQHVslnQQQQQQRLQAFQVRQS
314- 328 (22.19/ 6.25) PSACM...AALQQQQQQA......
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 77.27| 25| 102| 551| 577| 4
---------------------------------------------------------------------------
551- 575 (42.25/18.30) RKKDLSKMKSLLNILTDPSTRCPLK
655- 679 (35.02/13.37) RKHEEDERQTIPNILQGEVARLDVK
---------------------------------------------------------------------------
|