<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29618
| Description |
Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MAEMFSTLFGSNEAQGPPGSSSLGFGPGKPPPPMPQNQVAMAGQIPPQLGDEGPALRKPGAMNEPFYLLRELPVGNELTGNTNLITHYNLEHAYNKFCGKKVKEKLSNFLPELPGMIDCPGTQDGSSLRSLIDKPPVCGNSFSPLTGALLTGFRLHTGPLPEQYRLMHIQPPKKKSKHKHKHHRPQDPLPQETPSDSDPKKKKKKRDDDPDRKKKKKDKKKKKNRHSPDHPGLAGSQPNSNSLR |
| Length | 244 |
| Position | Head |
| Organism | Oreochromis niloticus (Nile tilapia) (Tilapia nilotica) |
| Kingdom | Metazoa |
| Lineage | |
| Aromaticity | 0.05 |
| Grand average of hydropathy | -1.064 |
| Instability index | 50.15 |
| Isoelectric point | 9.76 |
| Molecular weight | 26918.52 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP29618
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 69.38| 14| 17| 198| 212| 1
---------------------------------------------------------------------------
178- 190 (21.76/ 7.39) ..HKHKHHRPQDPLP
198- 212 (22.15/12.37) DpKKKKKKRDDDPDR
218- 230 (25.47/10.01) D.KKKKKNR.HSPDH
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 56.74| 18| 21| 98| 115| 3
---------------------------------------------------------------------------
98- 115 (32.08/16.13) C.GKKVKEKLSNFL..PELPG
119- 139 (24.66/11.02) CpGTQDGSSLRSLIdkPPVCG
---------------------------------------------------------------------------
|