<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29612

Description Mediator complex subunit 23
SequenceMETQLQSIFEDVVKTEMIEEAFAGMFMDTPEDERTKLISCLGAFRQYWGTLPQESHEQCVQWIVRFIHSQHSPKRISFLYDCLAMAVETSLLPPRMVCVALISSDSLEWERTQLWALTFKLIRKIIGGVDYKGVRDLLKAVLDKIQTIPTTVSSAIVQQLLAAREVVEYILDRNACLLPAYFAITEIRKLYPEGQLSHWLLGSLISDFVDSFRPTARINSICGRCSLLPVVNNSGAICNSWKLDPSTLRFPLRGMLPFDKDLFEPQTGLLRYVLEQPYSREMVCNMLGLNKQHKQRCPVLEEQLVDLVVYAMERSETEEHFDADIGGTSQLLWQHLSSQLIFFVLFQFASFPHMVLSLHQKLAGRGLIKGRDHLMWVLLQFISGSIQKNALADFLPVMKLFDLLYPEKECIPVPDINKPQSTHSFAMTCIWIHLNRKAQNDNSKLQIPIPHSLKLHHEFLQQSLRNKTLGMSDYKIALLCNAYSTNSECFTLPMGVLVETIYGNGSMRINLPGTNCMASGSVTPLPMNLLDSLTVHAKMSLIHSIATRVIKLAHAKSSIALAPALVETYSRLLVYMEIESLGIKGFISQLLPNVFKSHAWGILHTLLEMFSYRMHHIQPHYRVQLLSHLHSLAAVPQTNQNQLHLCVESTALRLITALGSSEVQPQFTRFLNDPKTVLSAESEELNRALILTLARATHVTDFFTGSDSIQGTWCKDILQTIMSFTPHNWASHTLSCFPAPLQAFFKQNNVPQESRFNLKKNVEEEYRKWKSMANENDIITHFSMQGSPPLFLCLLWKMLLEMDHINQIGFRVLERIGARALVAHVRTFADFLVYEFSTSAGGQQLNKCIEILNDMVWKYNIVTLDRLILCLAMRSHEGNEAQVCYFIIQLLLLKPNDFRNRVNDFVKENAPEHWLQNDWHSKHMNYHKKYPEKLYFEGLADQVNPPMQLQPQYLPIYFGNVCLRFLPVFDIVIHRFLELLPVSKSLETLLDHLGGLYKFHDRPVTYLYNTLHYYERHLRDRTNLKRKLVHAIMSSLKDNRTPGWCLSETYLRFGMNAREENVWIPDDTYYCKLIGRLVDTMAGKSPGPFPNCDWRFNEFPNPAAHALHVTCVELMALAVPGKDVGNALLNVVLKSQPLVPRENITAWMNAIGLVITALPEPYWIVLHDRIVSVISSPALTSETEWTGYPFALLDFTACHQSYSEMNCSYVLALAHAVWHHSSIGQLSLIPKFLSETLKPIVKTEFQLLYVYHLVGPFLQRFQQERTRCMLEIGVAFYEMLQAVDKHCQHLSYMDPICDFLYHIKYMYTGDSVKEQVEKIIMTLRPAMKLRLRFITHSSKIETSSSAASAASASSTSSSSATPQPPPSTLSSSTAAASPSPSQ
Length1382
PositionTail
OrganismOreochromis niloticus (Nile tilapia) (Tilapia nilotica)
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Actinopterygii> Neopterygii> Teleostei> Neoteleostei> Acanthomorphata> Ovalentaria> Cichlomorphae> Cichliformes> Cichlidae> African cichlids> Pseudocrenilabrinae> Oreochromini> Oreochromis.
Aromaticity0.10
Grand average of hydropathy-0.035
Instability index45.90
Isoelectric point7.20
Molecular weight157627.03
Publications









Function






Annotated function


GO - Cellular Component
nucleus	GO:0005634	IEA:UniProtKB-SubCell

GO - Biological Function
GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP29612
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      90.08|      26|     713|      29|      56|       1
---------------------------------------------------------------------------
   29-   56 (43.77/32.29)	TPEDERTKLISCLGA.....FRQywGTLPQESH
  725-  755 (46.31/26.09)	TPHNWASHTLSCFPAplqafFKQ..NNVPQESR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     218.76|      71|      80|     452|     527|       2
---------------------------------------------------------------------------
  452-  527 (115.34/82.08)	SLKLHHEF.LQQSLRNKTLGMSDYK..IALLCNAYSTNSEcftLPMGVLVETIYGNGSMRINLPgtNCMASGSV....TPLPM
  532-  609 (103.43/60.49)	SLTVHAKMsLIHSIATRVIKLAHAKssIALAPALVETYSR...LLVYMEIESLGIKGFISQLLP..NVFKSHAWgilhTLLEM
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     146.37|      40|      89|    1067|    1108|       3
---------------------------------------------------------------------------
 1067- 1108 (73.08/43.55)	DTYYCKLIGRLVDTMAgkSPGPFPNCDWRFNEFPNPAAHALH
 1160- 1199 (73.29/38.40)	EPYWIVLHDRIVSVIS..SPALTSETEWTGYPFALLDFTACH
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             4|     160.51|      38|     713|     189|     230|       4
---------------------------------------------------------------------------
  189-  225 (57.94/41.87)	...........KLYP...........EGQLSHWLLGSLISDFVDSFRPtARINSICGRC
  933-  964 (45.26/25.80)	...........KLYF...........EG.LADQVNPPM..QLQPQYLP.IYFGNVCLR.
  967- 1002 (16.94/ 7.50)	PVfdivihrflELLP......vskslETLLDH..LGGLYK.FHD..R............
 1003- 1045 (40.36/15.83)	PV........tYLYNtlhyyerhlrdRTNLKRKLVHAIMSSLKDNRTP........GWC
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      44.27|      14|      84|    1236|    1252|       7
---------------------------------------------------------------------------
 1232- 1246 (18.46/15.20)	FLSETLKPIVKtEFQ
 1249- 1262 (25.81/ 9.93)	YVYHLVGPFLQ.RFQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      31.74|      10|      28|     135|     144|       8
---------------------------------------------------------------------------
  135-  144 (15.32/10.34)	RDLLKAVLDK
  164-  173 (16.41/11.64)	REVVEYILDR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      47.07|      14|      28|     624|     637|       9
---------------------------------------------------------------------------
  624-  637 (23.82/15.73)	QLLSHLHSLAAVPQ
  653-  666 (23.25/15.15)	RLITALGSSEVQPQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      38.14|      10|      30|     341|     350|      14
---------------------------------------------------------------------------
  341-  350 (18.69/10.21)	IFFVLFQFAS
  374-  383 (19.45/10.93)	LMWVLLQFIS
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP29612 with Med23 domain of Kingdom Metazoa
Unable to open file!