<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29610
Description |
Cyclin C |
Sequence | MKERQKDLKFLTEEEYWKLQIFFANVIQALGEHLKLRQQVIATATVYFKRFYARYSLKSIDPVLMAPTCVFLASKVEEFGVVSNTRLISAATSVLKTRFSFAFPKEFPYRMNHILECEFYLLELMDCCLIVYHPYRPLLQYVQDMGQEDMLLPLAWRIVNDTYRTDLCLLYPPFMIALACLHVACVVQQKDARQWFAELSVDMDKILEIIRVILKLYDQWKNFDDRKEIAAVLNKMPKPKPPPNSESDQSSNGNQSNSYSQS |
Length | 262 |
Position | Kinase |
Organism | Oreochromis niloticus (Nile tilapia) (Tilapia nilotica) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Teleostei> Neoteleostei> Acanthomorphata>
Ovalentaria> Cichlomorphae> Cichliformes> Cichlidae> African cichlids>
Pseudocrenilabrinae> Oreochromini> Oreochromis.
|
Aromaticity | 0.12 |
Grand average of hydropathy | -0.123 |
Instability index | 48.78 |
Isoelectric point | 7.54 |
Molecular weight | 30667.40 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
|
GO - Biological Process | cell division GO:0051301 IEA:UniProtKB-KW
regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP29610
No repeats found
|