<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29607
Description |
Mediator of RNA polymerase II transcription subunit 25 (Fragment) |
Sequence | MDPTSKSGLNQVSDVVFVIEGTANLGPYFESLRNNYILPTIEYFNGGPPAETDFGGDYGGTQYGLVVFNTVDCAPESYVQCHAPTSSAFEFVSWIDSIQFMGGGAESCSLIAEGLSVALQLFDDFKKMREQIGQTHKVCVLLCNSPPYLLPAVESVSYTGCTADSLVQIIRD |
Length | 172 |
Position | Unknown |
Organism | Danio rerio (Zebrafish) (Brachydanio rerio) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Teleostei> Ostariophysi> Cypriniformes>
Danionidae> Danioninae> Danio.
|
Aromaticity | 0.11 |
Grand average of hydropathy | 0.069 |
Instability index | 42.71 |
Isoelectric point | 4.22 |
Molecular weight | 18603.70 |
Publications | PubMed=23594743
|
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP29607
No repeats found
No repeats found
|