<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29606
| Description |
Mediator of RNA polymerase II transcription subunit 25 |
| Sequence | MDPTSKSGLNQVSDVVFVIEGTANLGPYFESLRNNYILPTIEYFNGGPPAETDFGGDYGGTQYGLVVFNTVDCAPESYVQCHAPTSSAFEFVSWIDSIQFMGGGAESCSLIAEGLSVALQLFDDFKKMREQIGQTHKVLPTRLWHGVEF |
| Length | 149 |
| Position | Unknown |
| Organism | Danio rerio (Zebrafish) (Brachydanio rerio) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Teleostei> Ostariophysi> Cypriniformes>
Danionidae> Danioninae> Danio.
|
| Aromaticity | 0.13 |
| Grand average of hydropathy | -0.066 |
| Instability index | 42.15 |
| Isoelectric point | 4.38 |
| Molecular weight | 16317.06 |
| Publications | PubMed=23594743
|
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP29606
No repeats found
No repeats found
|