<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29603
| Description |
Mediator of RNA polymerase II transcription subunit 31 |
| Sequence | MSRFVEELEFMQCLCNPQYLQYLYQQGYFNKPEFREFLSYLRYWKRPEFAKYLFFPQCLNILDLLIDSKEFVESLKYKQIVELMASQQYFQWKNRR |
| Length | 96 |
| Position | Middle |
| Organism | Nematocida parisii (strain ERTm3) (Nematode killer fungus) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Fungi incertae sedis> Microsporidia> Nematocida.
|
| Aromaticity | 0.22 |
| Grand average of hydropathy | -0.477 |
| Instability index | 62.81 |
| Isoelectric point | 8.42 |
| Molecular weight | 12128.94 |
| Publications | PubMed=22813931
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP29603
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 119.58| 27| 36| 3| 38| 1
---------------------------------------------------------------------------
3- 29 (51.19/17.24) RFVEELEFMQCLCNPQYLQYLYQQGYF
42- 62 (32.55/17.72) RYWKRPEFAKYLFFPQCLNIL......
65- 90 (35.85/11.47) .LIDSKEFVESLKYKQIVELMASQQYF
---------------------------------------------------------------------------
|