<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29602
| Description |
Mediator of RNA polymerase II transcription subunit 31 |
| Sequence | MGRFSFNRYGYNTMQMESVESEKTRFEVECEFVQALANPNYLNFLAQRGYFKEEYFVNYLKYLLYWKDPQYARCLKFPQCLHMLEALQSQQFRDSMAYGPSAKFVEDQVVLQWQFYLRKRHRLCMMPDEGQELEESEDEADIRQKDTEDEDDEETMKKPDADTAEKNSTTSTVSKKEK |
| Length | 178 |
| Position | Middle |
| Organism | Caenorhabditis elegans |
| Kingdom | Metazoa |
| Lineage | |
| Aromaticity | 0.13 |
| Grand average of hydropathy | -0.961 |
| Instability index | 45.62 |
| Isoelectric point | 4.84 |
| Molecular weight | 21331.64 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP29602
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 63.34| 19| 22| 128| 146| 1
---------------------------------------------------------------------------
128- 146 (31.15/18.27) DEGQELEESEDEADIRQKD
149- 167 (32.19/19.08) DEDDEETMKKPDADTAEKN
---------------------------------------------------------------------------
|