<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29599
Description |
Mediator of RNA polymerase II transcription subunit 19 |
Sequence | MTTETNPPDYYYYIDPQTYYQPQQPNPLDDLISIYNLKDLSKQVARSNLDGTKAVKLRKSYKNQISDLSGKFNIIPTRENGKGGEISNILFQNNADMLSDGSNYMDLKKQNYQEYLQKMKNRDLSLFNLPNIDWNLCNNVISNFEKSYPAEFQNNSIINNFQIDDLAFDFDGTGNLNLSSANSNNTNNVSNPGSTGGTTASSMKNGSQQKKRKNKSNGSSMATPNSEFNDDVKRRRLE |
Length | 238 |
Position | Head |
Organism | Tetrapisispora blattae (strain ATCC 34711 / CBS 6284 / DSM 70876 / NBRC 10599 / NRRL Y-10934 / UCD 77-7) (Yeast) (Kluyveromyces blattae) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Saccharomycetaceae> Tetrapisispora.
|
Aromaticity | 0.09 |
Grand average of hydropathy | -1.003 |
Instability index | 41.70 |
Isoelectric point | 7.67 |
Molecular weight | 26953.37 |
Publications | PubMed=22123960
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151
|
GO - Cellular Component | core mediator complex GO:0070847 IEA:EnsemblFungi
mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coactivator activity GO:0003713 IEA:EnsemblFungi
|
GO - Biological Process | negative regulation of transcription by RNA polymerase II GO:0000122 IEA:EnsemblFungi
positive regulation of transcription by RNA polymerase II GO:0045944 IEA:EnsemblFungi
RNA polymerase II preinitiation complex assembly GO:0051123 IEA:EnsemblFungi
transcription open complex formation at RNA polymerase II promoter GO:0001113 IEA:EnsemblFungi
|
Interaction
Repeat regions
Repeats |
>MDP29599
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 81.09| 19| 19| 194| 212| 2
---------------------------------------------------------------------------
173- 190 (21.32/ 8.97) .TGNLNLSSANSNNTNNVS
194- 212 (30.03/15.57) STGGTTASSMKNGSQQKKR
216- 234 (29.74/15.35) SNGSSMATPNSEFNDDVKR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 108.10| 31| 90| 9| 40| 3
---------------------------------------------------------------------------
9- 40 (55.75/33.19) DYYYYID..PQTYYQPQQPNPLDDLiSIYNLKDL
100- 132 (52.35/27.19) DGSNYMDlkKQNYQEYLQKMKNRDL.SLFNLPNI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 51.35| 18| 18| 49| 66| 4
---------------------------------------------------------------------------
49- 66 (29.50/17.45) LDGT.KAVKLRKSYK.NQIS
68- 87 (21.85/11.38) LSGKfNIIPTRENGKgGEIS
---------------------------------------------------------------------------
|