| Description | Mediator of RNA polymerase II transcription subunit 4 |
| Sequence | MSDFHNTLPHHGHHKTLSTSISEGDVLQDNNDKNDELSKIQTYNDLIQYEETLSKLSSSVDKYKPDLQYAYDLIDIDRKLYSTLDSFVKYDEISTKLKKLEIDTKALDEKTKSVLDSLNDCHELLNTLPMLEQVEFEKNTMLKQREKINSKVLLDYATKLAKFTKIPPTFNKNTLGPNNFIWPAEDALRRGMLAVASAHTEELTALPGSVGDEENSKDISQLNADDVTNKDNHMDMDITVEGQDRFRRGSFTFGSLDASPKRFELSNDNAANYNSNNNSNSNNSRTNDPNTGAQNGKEENNEEDAMDLDLDLFDPDEF |
| Length | 318 |
| Position | Middle |
| Organism | Tetrapisispora blattae (strain ATCC 34711 / CBS 6284 / DSM 70876 / NBRC 10599 / NRRL Y-10934 / UCD 77-7) (Yeast) (Kluyveromyces blattae) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes> Saccharomycetales> Saccharomycetaceae> Tetrapisispora. |
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.897 |
| Instability index | 32.75 |
| Isoelectric point | 4.62 |
| Molecular weight | 36060.15 |
| Publications | PubMed=22123960 |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364141 |
| GO - Cellular Component | core mediator complex GO:0070847 IEA:EnsemblFungi mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | RNA polymerase II core promoter sequence-specific DNA binding GO:0000979 IEA:EnsemblFungi transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro transcription by RNA polymerase II GO:0006366 IEA:EnsemblFungi |
| Binary Interactions |
| Repeats |
>MDP29595
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 72.39| 23| 25| 40| 63| 1
---------------------------------------------------------------------------
40- 63 (35.89/23.14) IQTYNDLIQYEETL.SKLSSSVdKY
67- 90 (36.50/19.21) LQYAYDLIDIDRKLySTLDSFV.KY
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 58.77| 18| 56| 185| 207| 3
---------------------------------------------------------------------------
185- 207 (24.74/30.83) EDALRRGMLAVASahteeLTALP
243- 260 (34.04/25.50) QDRFRRGSFTFGS.....LDASP
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) EENNEEDAMDLDLDLFDPDEF 2) RFRRG | 298 245 | 318 249 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab