<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29587
| Description |
Uncharacterized protein |
| Sequence | MTDRLTQLQICLDQMMEQFCATLNYIDKNHDFEPFDHTEPKMTDSHAVIAPPEEFSNTIDELSTDIILKTRQISKLIDSLPGVDVSEEEQLHKIDSLQKELVKVEEQKIEAIKRKEKLSSQVDNLIKSLVDGIADARKTTVPVNHNNIPN |
| Length | 150 |
| Position | Middle |
| Organism | Tetrapisispora blattae (strain ATCC 34711 / CBS 6284 / DSM 70876 / NBRC 10599 / NRRL Y-10934 / UCD 77-7) (Yeast) (Kluyveromyces blattae) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Saccharomycetaceae> Tetrapisispora.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.546 |
| Instability index | 51.51 |
| Isoelectric point | 4.81 |
| Molecular weight | 17125.22 |
| Publications | PubMed=22123960
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | core mediator complex GO:0070847 IEA:EnsemblFungi
mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
| GO - Biological Function | RNA polymerase II repressing transcription factor binding GO:0001103 IEA:EnsemblFungi
transcription coactivator activity GO:0003713 IEA:EnsemblFungi
transcription corepressor activity GO:0003714 IEA:EnsemblFungi
|
| GO - Biological Process | negative regulation of transcription by RNA polymerase II GO:0000122 IEA:EnsemblFungi
positive regulation of transcription by RNA polymerase II GO:0045944 IEA:EnsemblFungi
|
Interaction
Repeat regions
| Repeats |
>MDP29587
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
4| 83.52| 14| 15| 67| 80| 1
---------------------------------------------------------------------------
49- 62 (22.56/12.65) IAPPEEFSNTIDEL
67- 80 (20.65/11.11) ILKTRQISKLIDSL
85- 97 (20.23/10.78) VSEEEQLHK.IDSL
112- 125 (20.09/10.67) IKRKEKLSSQVDNL
---------------------------------------------------------------------------
|