Description | Mediator of RNA polymerase II transcription subunit 20 |
Sequence | MEHTAVIFIEKCTPNTLIEFKDIISHSIIKNLENWSLEFRTYRSIFKDKKNPNNNSLLYSINLTQFNKTILIKDGEIILNTVNFNDIPKELLFNGCNNGSSMSIDKLITNKLSNMWSNRQSIRGENGESFVCNNKLIVRIINLFSLTGFKGMLIEIENYDKKMETQEFNNHVDKICEFLNDIKVKDYKINKDRTDEDEFLCDLGQQYVSVLE |
Length | 212 |
Position | Head |
Organism | Tetrapisispora blattae (strain ATCC 34711 / CBS 6284 / DSM 70876 / NBRC 10599 / NRRL Y-10934 / UCD 77-7) (Yeast) (Kluyveromyces blattae) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes> Saccharomycetales> Saccharomycetaceae> Tetrapisispora. |
Aromaticity | 0.09 |
Grand average of hydropathy | -0.402 |
Instability index | 23.87 |
Isoelectric point | 5.54 |
Molecular weight | 24738.00 |
Publications | PubMed=22123960 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364152 |
GO - Cellular Component | core mediator complex GO:0070847 IEA:EnsemblFungi mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | protein domain specific binding GO:0019904 IEA:EnsemblFungi TFIID-class transcription factor complex binding GO:0001094 IEA:EnsemblFungi transcription coactivator activity GO:0003713 IEA:EnsemblFungi |
GO - Biological Process | negative regulation of ribosomal protein gene transcription from RNA polymerase II promoter in response to chemical stimulus GO:0010689 IEA:EnsemblFungi negative regulation of ribosomal protein gene transcription from RNA polymerase II promoter in response to nutrient levels GO:0010691 IEA:EnsemblFungi positive regulation of transcription by RNA polymerase II GO:0045944 IEA:EnsemblFungi RNA polymerase II preinitiation complex assembly GO:0051123 IEA:EnsemblFungi |
Binary Interactions |
Repeats | >MDP29586 No repeats found |
MoRF Sequence | Start | Stop |
1) EFRTYRSIFKD 2) SLLYSI | 38 56 | 48 61 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab