<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29580
| Description |
Uncharacterized protein |
| Sequence | MSGSYWTSTQRSKWQFTRQSLARERACLWNTELQQYPNGLNVIMDTPSKRDNNNNTTNSNGHQIYAKNIPIAARDLHWSKDYNLRIYSYFLIMKLGRRLNIRQCALATAQIYMARFLLKVSVREINLFLLVTTCVYLSCKVEECPQYIRTLVSEARSLWPEYIPPDPTKVTEFEFYLIEELDSYLIVHHPYNSMEEIIKCLKQEPYNLKLNNEDIQNCWSLINDSYIINEVHLLYSPHIIAVSCLFITICLRNVKSINNYNNMNSGVNEDSRNNTNSNMEINKKKQEIFNRFLAESQINLEEVMDTIQQTITLYEHWESYQEVWIKFLLHALYLRNPTKMN |
| Length | 341 |
| Position | Kinase |
| Organism | Tetrapisispora blattae (strain ATCC 34711 / CBS 6284 / DSM 70876 / NBRC 10599 / NRRL Y-10934 / UCD 77-7) (Yeast) (Kluyveromyces blattae) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Saccharomycetaceae> Tetrapisispora.
|
| Aromaticity | 0.11 |
| Grand average of hydropathy | -0.409 |
| Instability index | 53.72 |
| Isoelectric point | 7.06 |
| Molecular weight | 40403.74 |
| Publications | PubMed=22123960
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:EnsemblFungi
|
| GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:EnsemblFungi
RNA polymerase II core promoter sequence-specific DNA binding GO:0000979 IEA:EnsemblFungi
|
| GO - Biological Process | negative regulation of transcription by RNA polymerase II GO:0000122 IEA:EnsemblFungi
positive regulation of transcription by galactose GO:0000411 IEA:EnsemblFungi
positive regulation of transcription from RNA polymerase II promoter involved in meiotic cell cycle GO:0010673 IEA:EnsemblFungi
|
Interaction
Repeat regions
| Repeats |
>MDP29580
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 77.07| 23| 43| 177| 201| 1
---------------------------------------------------------------------------
177- 201 (39.19/32.04) LIEelDSYLI..VHHPYNSMEEIIKCL
221- 245 (37.89/24.46) LIN..DSYIIneVHLLYSPHIIAVSCL
---------------------------------------------------------------------------
|