<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29575
| Description |
Mediator of RNA polymerase II transcription subunit 6 |
| Sequence | MSDPAAAGAVATDATPNLLHVQFKDPEFLSYLSHLQSTGQVAPPSDGSKIDPNHPLTEHNVMAYFATSPFFDRRSNNEQIRMQNIANGIQNLTGGMGARQEEEELKRFTGLEFVLVHSRAPLCFVLQKRWRTSATETTPLAAYYIINDSIYQAPDMYSILATRLQSTVYGLKSSLSAQRRARPSFDPRRGHHGRFIVPDPPTDSATSGAGKNGNSATLTQEDEEEEEEDGAEAQGEDDEMEFEDVAGNDAPPTSAAGAPQVKRARFH |
| Length | 267 |
| Position | Head |
| Organism | Ustilago hordei (strain Uh4875-4) (Barley covered smut fungus) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Ustilaginomycotina>
Ustilaginomycetes> Ustilaginales> Ustilaginaceae> Ustilago.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.651 |
| Instability index | 60.48 |
| Isoelectric point | 4.97 |
| Molecular weight | 29281.88 |
| Publications | PubMed=22623492
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP29575
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 91.10| 28| 126| 11| 38| 2
---------------------------------------------------------------------------
11- 38 (50.90/36.89) ATDATPNLLHVQFKD.....PEFLSYL.SHLQST
134- 167 (40.20/27.76) ATETTPLAAYYIINDsiyqaPDMYSILaTRLQST
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 59.50| 18| 19| 218| 235| 6
---------------------------------------------------------------------------
218- 235 (28.70/17.33) LTQEDEEEEEEDGAEAQG
240- 257 (30.80/19.10) MEFEDVAGNDAPPTSAAG
---------------------------------------------------------------------------
|