Description | Mediator of RNA polymerase II transcription subunit 6 |
Sequence | MSDPAAAGAVATDATPNLLHVQFKDPEFLSYLSHLQSTGQVAPPSDGSKIDPNHPLTEHNVMAYFATSPFFDRRSNNEQIRMQNIANGIQNLTGGMGARQEEEELKRFTGLEFVLVHSRAPLCFVLQKRWRTSATETTPLAAYYIINDSIYQAPDMYSILATRLQSTVYGLKSSLSAQRRARPSFDPRRGHHGRFIVPDPPTDSATSGAGKNGNSATLTQEDEEEEEEDGAEAQGEDDEMEFEDVAGNDAPPTSAAGAPQVKRARFH |
Length | 267 |
Position | Head |
Organism | Ustilago hordei (strain Uh4875-4) (Barley covered smut fungus) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Ustilaginomycotina> Ustilaginomycetes> Ustilaginales> Ustilaginaceae> Ustilago. |
Aromaticity | 0.07 |
Grand average of hydropathy | -0.651 |
Instability index | 60.48 |
Isoelectric point | 4.97 |
Molecular weight | 29281.88 |
Publications | PubMed=22623492 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364143 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP29575 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 91.10| 28| 126| 11| 38| 2 --------------------------------------------------------------------------- 11- 38 (50.90/36.89) ATDATPNLLHVQFKD.....PEFLSYL.SHLQST 134- 167 (40.20/27.76) ATETTPLAAYYIINDsiyqaPDMYSILaTRLQST --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 59.50| 18| 19| 218| 235| 6 --------------------------------------------------------------------------- 218- 235 (28.70/17.33) LTQEDEEEEEEDGAEAQG 240- 257 (30.80/19.10) MEFEDVAGNDAPPTSAAG --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) EEEEEDGAEAQGEDDEMEFEDVA 2) SAAGAPQVKRARFH | 224 254 | 246 267 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab