<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29551
Description |
Uncharacterized protein |
Sequence | MDSTSSTNLLDKHNKLIFEILRSYRDLMNCATVQGMDKANQNDFEAQTTKLNYRDPDTMAAAEIRTQRKFDQLHDNIKELLALSRTIKELWVFGPLDRADGHRQEKEVQIDRDVQEVSRLMDNFDMKAMRELAEQFGGTYEPQAAATAAATASSSSVVTTTEPAPATGN |
Length | 169 |
Position | Head |
Organism | Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) (Wheat head blight fungus) (Fusarium graminearum) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Hypocreomycetidae> Hypocreales> Nectriaceae> Fusarium.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -0.666 |
Instability index | 32.45 |
Isoelectric point | 4.99 |
Molecular weight | 18987.97 |
Publications | PubMed=17823352
PubMed=20237561
PubMed=26198851
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP29551
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 54.22| 22| 28| 11| 38| 1
---------------------------------------------------------------------------
1- 35 (27.53/33.91) MDStsstnllDKHNKLifeilrSYR..DLMNCATVQG
36- 66 (26.70/17.73) MDKanqndfeAQTTKL......NYRdpDTMAAAEIRT
---------------------------------------------------------------------------
|