<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29546
| Description |
Uncharacterized protein |
| Sequence | MSASYWQSTQCRFWTFTKEQLATMRQKLEEDNAELVRMFPLPQQRHLNIYFNQQLIRLAKRLTIRQQSMATAQVYMKRFYSKVEIRRTNPYLVIATAIYLACKIEESPQHIRLIVTEARQMWGDLVAIDTSKLGECEFFMISEMRSQLIVYQPYRTVVALRSELGLQEDEVQLARSVINDHFMTDLPLLYPPHVIAMVAMLLALVLRPNNSGPGQNPSGAAAAAGLAAAQQALMRAQGQQTSGGGATDAATAEPKERQQQARVSRVQKFAKWLVDSNVEIASMVDATQEIISFYECYEHYNDKLTREQINRFVKARGLDK |
| Length | 320 |
| Position | Kinase |
| Organism | Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) (Wheat head blight fungus) (Fusarium graminearum) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Hypocreomycetidae> Hypocreales> Nectriaceae> Fusarium.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.277 |
| Instability index | 54.92 |
| Isoelectric point | 8.96 |
| Molecular weight | 36544.66 |
| Publications | PubMed=17823352
PubMed=20237561
PubMed=26198851
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP29546
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 42.75| 13| 22| 214| 235| 2
---------------------------------------------------------------------------
214- 228 (18.44/23.71) GQNPSGAAAAAglAA
238- 250 (24.30/ 7.27) GQQTSGGGATD..AA
---------------------------------------------------------------------------
|