<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29539
| Description |
Uncharacterized protein |
| Sequence | MEEVQHPLHDHQQWMGLMQPQSQHNQQHQSQQHIMAAFQSQSNQLQQELGMEQKPSVQQNFQTSAGMFLXXXXXXXXXXXXXXXXXXXXXXXXXX |
| Length | 95 |
| Position | Tail |
| Organism | Oryza glaberrima (African rice) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Oryzoideae> Oryzeae> Oryzinae> Oryza.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -1.107 |
| Instability index | 89.12 |
| Isoelectric point | 5.73 |
| Molecular weight | 8096.87 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | chromatin DNA binding GO:0031490 IEA:InterPro
transcription coactivator activity GO:0003713 IEA:InterPro
|
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP29539
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 75.93| 15| 15| 11| 25| 1
---------------------------------------------------------------------------
11- 25 (33.33/16.25) HQQWMGLMQ.P.QSQHN
28- 43 (21.54/ 8.16) HQSQQHIMA.AfQSQSN
45- 60 (21.05/ 7.83) LQQELGMEQkP.SVQQN
---------------------------------------------------------------------------
|