<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29517
| Description |
Uncharacterized protein |
| Sequence | MDIISQLQEQLNEMAMVAVNTFGTLQRDAPPVRLSNNYPDPLNPAAAAANPNPDDPAQPQPGAAAAAPGAPAAQAQAPPAQAQPPALDLAEHPKAMSHALVLAAKKMQFDALVSALPLSSEEDQLKRIKELQAENEVVGSELQKQLEAAELELKQVEALFNEATDHCINLKKPE |
| Length | 174 |
| Position | Middle |
| Organism | Oryza glaberrima (African rice) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Oryzoideae> Oryzeae> Oryzinae> Oryza.
|
| Aromaticity | 0.02 |
| Grand average of hydropathy | -0.374 |
| Instability index | 51.72 |
| Isoelectric point | 4.57 |
| Molecular weight | 18490.67 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU366036
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP29517
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 60.99| 17| 21| 56| 76| 2
---------------------------------------------------------------------------
56- 73 (28.17/17.61) PAQPQPGAAAAAPgAPAA
79- 95 (32.82/ 9.93) PAQAQPPALDLAE.HPKA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 63.00| 23| 25| 105| 129| 4
---------------------------------------------------------------------------
107- 129 (37.52/25.44) MQFDALV..SAL..PLSSEEDQLKRIK
131- 157 (25.47/ 9.84) LQAENEVvgSELqkQLEAAELELKQVE
---------------------------------------------------------------------------
|