<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29512
Description |
Mediator of RNA polymerase II transcription subunit 31 |
Sequence | MEEAEARPAPPDPNDARQRFLLELEFIQCLANPTYIHYLAQNRYFEDEAFIGYLKYLKYWQRPEYIKYIMYPHCLFFLELLQNANFRNAMAHPASKEIAHRQQYFFWKNYRNNRLKHILPRPPPEPTPMPATAPAAVPPAAPVPSTVVPPAAAPPSSLPPMSAAGASAMSPMQFAGTPGTNIPKNDMRNVMGGQGGRKRNSLCSDILPCELFSV |
Length | 214 |
Position | Middle |
Organism | Oryza glaberrima (African rice) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Oryzoideae> Oryzeae> Oryzinae> Oryza.
|
Aromaticity | 0.11 |
Grand average of hydropathy | -0.405 |
Instability index | 61.54 |
Isoelectric point | 8.87 |
Molecular weight | 24132.55 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP29512
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 66.79| 14| 14| 126| 139| 2
---------------------------------------------------------------------------
122- 137 (23.98/ 7.84) PPpePTPMPATAPAAV
138- 153 (21.69/ 6.48) PPaaPVPSTVVPPAAA
154- 169 (21.12/ 6.14) PPssLPPMSAAGASAM
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 62.77| 17| 18| 56| 72| 3
---------------------------------------------------------------------------
56- 72 (33.61/24.16) YLKYWQRPEYIKYIMYP
77- 93 (29.16/20.00) FLELLQNANFRNAMAHP
---------------------------------------------------------------------------
|