<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29502
| Description |
Mediator of RNA polymerase II transcription subunit 7 |
| Sequence | MATSSAYPPPPPYYRLYKDYEKDPSSAPEPPPPVDGPYQLFGATYTTDVVLPSLEDQGVRQLYPKSPDIDFKKELRTLNRELQLHILELADILVERPSQYARRVEDISLIFKNLHHLLNSLRPHQARATLIHMLENQIQRRKQAIEDIKQRREEAQKLLGESLLILDGNQPSLPAM |
| Length | 176 |
| Position | Middle |
| Organism | Oryza glaberrima (African rice) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Oryzoideae> Oryzeae> Oryzinae> Oryza.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.631 |
| Instability index | 66.12 |
| Isoelectric point | 6.21 |
| Molecular weight | 20275.93 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP29502
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 57.97| 14| 21| 4| 17| 1
---------------------------------------------------------------------------
4- 17 (32.42/14.84) SSAYPPPPPY...YRLY
25- 41 (25.55/10.42) SSAPEPPPPVdgpYQLF
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 52.90| 21| 38| 73| 107| 2
---------------------------------------------------------------------------
73- 107 (23.92/42.12) KELRTLNRELqlhileladilveRPSQyAR................RVEDI
112- 148 (28.99/16.32) KNLHHLLNSL.............RPHQ.ARatlihmlenqiqrrkqAIEDI
---------------------------------------------------------------------------
|