<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29479
| Description |
Mediator of RNA polymerase II transcription subunit 31 |
| Sequence | MASKIESENSTDTSPSSPKNIYKDPDDGQQRFLLELEFVQCLANPTYIHYLAQNRYFEDEAFIGYLKYLQYWQRPEYIKFIMYPHCLYFLELLQNANFRNAMAHPTNKELAHRQQFYFWKNYRNNRLKHILPRSLPEPATPAAPAPASTPSQAPVSALPPVPATSVAVTAAPSQAPSPMPYVMPPGSGLAKNDMRNPTVDNRRKRK |
| Length | 206 |
| Position | Middle |
| Organism | Glycine max (Soybean) (Glycine hispida) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade>
NPAAA clade> indigoferoid/millettioid clade> Phaseoleae> Glycine>
Glycine subgen. Soja.
|
| Aromaticity | 0.12 |
| Grand average of hydropathy | -0.645 |
| Instability index | 71.34 |
| Isoelectric point | 9.26 |
| Molecular weight | 23590.58 |
| Publications | PubMed=20075913
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP29479
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 61.86| 18| 20| 144| 162| 1
---------------------------------------------------------------------------
144- 162 (31.62/17.75) PAPASTPSQAPvSALPPV..P
166- 185 (30.23/13.21) VAVTAAPSQAP.SPMPYVmpP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 57.68| 16| 19| 47| 65| 2
---------------------------------------------------------------------------
47- 65 (25.94/21.46) YIHYLAQNRYFEdeaFIGY
68- 83 (31.74/18.73) YLQYWQRPEYIK...FIMY
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 34.27| 14| 22| 97| 110| 3
---------------------------------------------------------------------------
91- 108 (20.72/13.69) EL......lqnaNFRNA.MAHPTNK
109- 133 (13.55/ 6.39) ELahrqqfyfwkNYRNNrLKHILPR
---------------------------------------------------------------------------
|