Description | Mediator of RNA polymerase II transcription subunit 31 |
Sequence | MASKIESENSTDTSPSSPKNIYKDPDDGQQRFLLELEFVQCLANPTYIHYLAQNRYFEDEAFIGYLKYLQYWQRPEYIKFIMYPHCLYFLELLQNANFRNAMAHPTNKELAHRQQFYFWKNYRNNRLKHILPRSLPEPATPAAPAPASTPSQAPVSALPPVPATSVAVTAAPSQAPSPMPYVMPPGSGLAKNDMRNPTVDNRRKRK |
Length | 206 |
Position | Middle |
Organism | Glycine max (Soybean) (Glycine hispida) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade> NPAAA clade> indigoferoid/millettioid clade> Phaseoleae> Glycine> Glycine subgen. Soja. |
Aromaticity | 0.12 |
Grand average of hydropathy | -0.645 |
Instability index | 71.34 |
Isoelectric point | 9.26 |
Molecular weight | 23590.58 |
Publications | PubMed=20075913 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129 |
GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central mediator complex GO:0016592 IBA:GO_Central |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central |
Binary Interactions |
Repeats | >MDP29479 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 61.86| 18| 20| 144| 162| 1 --------------------------------------------------------------------------- 144- 162 (31.62/17.75) PAPASTPSQAPvSALPPV..P 166- 185 (30.23/13.21) VAVTAAPSQAP.SPMPYVmpP --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 57.68| 16| 19| 47| 65| 2 --------------------------------------------------------------------------- 47- 65 (25.94/21.46) YIHYLAQNRYFEdeaFIGY 68- 83 (31.74/18.73) YLQYWQRPEYIK...FIMY --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 34.27| 14| 22| 97| 110| 3 --------------------------------------------------------------------------- 91- 108 (20.72/13.69) EL......lqnaNFRNA.MAHPTNK 109- 133 (13.55/ 6.39) ELahrqqfyfwkNYRNNrLKHILPR --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) PKNIYK 2) PYVMPPGSGLAKNDMRNPT | 18 180 | 23 198 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab