<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29465
| Description |
Uncharacterized protein |
| Sequence | MDPEGKKFGGGPRELTGAVDLISHFKLLPHYEFFCKRPLPVSIADTHYLHNVVGDTEIRKGDGMQLDQLIQNTSFRDTNARIQPFDLDVLKEAFQLRETAPIDLPAAEKGIPTIAGKSKSENKDKEKKHKKHKDKDKDKDREHKKHKHRHKDRSKDKDKDKDRDKKKDKSGHRDSSADHSKKHHEKKRKHDGDDDVNDVHKHKKSKHKSSKIDELGAIKVAG |
| Length | 222 |
| Position | Head |
| Organism | Glycine max (Soybean) (Glycine hispida) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade>
NPAAA clade> indigoferoid/millettioid clade> Phaseoleae> Glycine>
Glycine subgen. Soja.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -1.466 |
| Instability index | 29.72 |
| Isoelectric point | 9.52 |
| Molecular weight | 25497.42 |
| Publications | PubMed=20075913
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
transcription factor binding GO:0008134 IBA:GO_Central
|
| GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP29465
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 81.65| 19| 19| 123| 141| 1
---------------------------------------------------------------------------
123- 139 (26.74/ 7.37) ....KDKEKKHK.KHKDKDKDK
140- 161 (25.28/ 6.55) DRehKKHKHRHKdRSKDKDKDK
180- 198 (29.63/ 8.98) SK..KHHEKKRK.HDGDDDVND
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 52.49| 15| 15| 45| 59| 2
---------------------------------------------------------------------------
45- 59 (26.46/19.83) DTHYLHNVVGDTEIR
62- 76 (26.03/19.41) DGMQLDQLIQNTSFR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 49.53| 14| 33| 165| 178| 3
---------------------------------------------------------------------------
165- 178 (24.45/11.32) KKKDKSGHRDSSAD
200- 213 (25.08/11.81) HKHKKSKHKSSKID
---------------------------------------------------------------------------
|