Description | Mediator of RNA polymerase II transcription subunit 20 |
Sequence | MPIRCILHWQPNQGSVVNSQVLNEISQCVESLNGVKEGRCKASLTFYRPNLRDQSVTIDFPRDFLGISMLEQPNKYYLIIRGQKIVLEADSSILLIMEKLQSYKSKVALHFEGVLYKLGDFQIRVIKVVPSQAESLRGIMIEIVENGGKPKICYII |
Length | 156 |
Position | Head |
Organism | Glycine max (Soybean) (Glycine hispida) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade> NPAAA clade> indigoferoid/millettioid clade> Phaseoleae> Glycine> Glycine subgen. Soja. |
Aromaticity | 0.08 |
Grand average of hydropathy | 0.014 |
Instability index | 36.86 |
Isoelectric point | 8.90 |
Molecular weight | 17741.64 |
Publications | PubMed=20075913 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364152 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP29451 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 59.22| 18| 41| 80| 97| 1 --------------------------------------------------------------------------- 80- 97 (29.15/22.95) IRGQKIVLEADSSILLIM 123- 140 (30.07/23.89) IRVIKVVPSQAESLRGIM --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) MPIRC 2) YYLIIR | 1 76 | 5 81 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab