| Description | Mediator of RNA polymerase II transcription subunit 20 |
| Sequence | MPIRCILHWQPNQGSVVNSQVLNEISQCVESLNGVKEGRCKASLTFYRPNLRDQSVTIDFPRDFLGISMLEQPNKYYLIIRGQKIVLEADSSILLIMEKLQSYKSKVALHFEGVLYKLGDFQIRVIKVVPSQAESLRGIMIEIVENGGKPKICYII |
| Length | 156 |
| Position | Head |
| Organism | Glycine max (Soybean) (Glycine hispida) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade> NPAAA clade> indigoferoid/millettioid clade> Phaseoleae> Glycine> Glycine subgen. Soja. |
| Aromaticity | 0.08 |
| Grand average of hydropathy | 0.014 |
| Instability index | 36.86 |
| Isoelectric point | 8.90 |
| Molecular weight | 17741.64 |
| Publications | PubMed=20075913 |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364152 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP29451
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 59.22| 18| 41| 80| 97| 1
---------------------------------------------------------------------------
80- 97 (29.15/22.95) IRGQKIVLEADSSILLIM
123- 140 (30.07/23.89) IRVIKVVPSQAESLRGIM
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) MPIRC 2) YYLIIR | 1 76 | 5 81 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab