<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29439

Description Mediator of RNA polymerase II transcription subunit 4
SequenceMLQHQIVQSPARLGLANPNSPSIPNPTPPKLPPTQTHHPQDRNSSTPSSALLSLLPPLPRAQALLAQMASLASKLFDVSPNRSLWVTAFRGSLPTFLSSHSSTPLDTSPSNAKEIISLFTVLQTQIFEAVAELQEILDLQDAKQKIDREIRSQDSTLLAFANKLKEAESCLDILVDDYSDYRRSKRSKSGDDDSMTSSTVSSQLKLSDILSYAHRISYTTFAPPEFGAGQAPLRGALPPAPQEEQMRASQLYNFADLDVGLPKEVETKEKIVEAIVEPPPQVDTNAVPNLSAFQGMLPPMPPGWKPGMPVQLPIDLPLPPPGWKPGDPVPLPPMDSLQIPRFAEQQMQPHIPQPKQPEVIQVQPVNLDLGGSDTSDYSSDDASSDDED
Length388
PositionMiddle
OrganismGlycine max (Soybean) (Glycine hispida)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade> NPAAA clade> indigoferoid/millettioid clade> Phaseoleae> Glycine> Glycine subgen. Soja.
Aromaticity0.05
Grand average of hydropathy-0.445
Instability index65.49
Isoelectric point4.74
Molecular weight42302.25
Publications
PubMed=20075913

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. 
ECO:0000256	RuleBase:RU364141
GO - Cellular Component
core mediator complex	GO:0070847	IBA:GO_Central
mediator complex	GO:0016592	IEA:InterPro
GO - Biological Function
transcription coregulator activity	GO:0003712	IBA:GO_Central
GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IBA:GO_Central

Interaction

Binary Interactions











Repeat regions





Repeats

>MDP29439
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      66.14|      13|      18|     301|     318|       1
---------------------------------------------------------------------------
  301-  313 (32.95/18.88)	PPGWKPGMPVQLP
  320-  332 (33.19/ 9.90)	PPGWKPGDPVPLP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      69.59|      25|      33|     129|     153|       2
---------------------------------------------------------------------------
  129-  153 (41.15/25.88)	AVA.ELQEI...LD.LQDAKQKIDREIRSQ
  159-  188 (28.44/16.04)	AFAnKLKEAescLDiLVDDYSDYRRSKRSK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     185.95|      60|     203|      15|      94|       3
---------------------------------------------------------------------------
   15-   94 (90.46/59.95)	LANPNSPSIPNPTPPKLPPTqTHHPQDRNSSTPSSALLSL.LP...............PLPRaqallaqmaslasklFDVS..PNrsLwvTAFRGSLP
  221-  298 (95.49/35.87)	FAPPEFGAGQAPLRGALPPA.PQEEQMRASQLYNFADLDVgLPkevetkekiveaivePPPQ...............VDTNavPN..L..SAFQGMLP
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP29439 with Med4 domain of Kingdom Viridiplantae


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) KEKIVEAIVEPPPQVDTNAVPNLSAFQGMLPPMPPGWKPGMPVQLPIDLPLPPPGWKPGDPVPLPPMDSLQIPRFAEQQMQPHIPQPKQPEVIQVQPVNLDLGGSDTSDYSSDDASSDDED
2) VQSPARLGLANPNSPSIPNPTPPKLPPTQTHHPQDRNSSTPSSALL
268
7
388
52










Molecular Recognition Features






MoRF SequenceStartStop




NANANA