<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29437
Description |
Uncharacterized protein |
Sequence | MDHYGSSGGSWTMIPTHNSQSQSNQDPNLFLQQQQQFLQSQPFQQALAPQSPFQQQQQQRLLQQQQQQQQPQNLHQSLASHYHLLHLVENLAEVIEHGTPDQPSDALINESSNHFEKCLQLLNSISGSISTKAMTVEGQKKKLEESEQLLNQRRDLIGNYRKSVEDLVRSEPVENVVL |
Length | 178 |
Position | Middle |
Organism | Glycine max (Soybean) (Glycine hispida) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade>
NPAAA clade> indigoferoid/millettioid clade> Phaseoleae> Glycine>
Glycine subgen. Soja.
|
Aromaticity | 0.05 |
Grand average of hydropathy | -0.878 |
Instability index | 86.78 |
Isoelectric point | 5.53 |
Molecular weight | 20333.22 |
Publications | PubMed=20075913
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP29437
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 69.66| 18| 21| 30| 50| 1
---------------------------------------------------------------------------
30- 47 (35.22/ 9.22) FLQQQQQFLQSQPFQQAL
61- 78 (34.44/ 8.82) LLQQQQQQQQPQNLHQSL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 52.83| 16| 27| 108| 123| 2
---------------------------------------------------------------------------
108- 123 (27.79/19.94) INESSNHFEKCLQLLN
136- 151 (25.04/17.29) VEGQKKKLEESEQLLN
---------------------------------------------------------------------------
|