<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29427
Description |
Uncharacterized protein |
Sequence | MDPEGKKFGGGPRELTGAVDLISHFKLLPHYEFFCKRSLPVSIADTHYLHNVVGDTEIRKGDGMQLEQLIQNTSSFRDTNARIQPFDLDVLKEAFQLRETAPIDLPAAEKGIPTIAGKSKGENKDKEKKHKKHKDKDKDKDKDREHKKHKHRHKDRTKDKDKDRDKKKDKSGHRDSSADHSKKHHEKVEKF |
Length | 191 |
Position | Head |
Organism | Glycine max (Soybean) (Glycine hispida) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade>
NPAAA clade> indigoferoid/millettioid clade> Phaseoleae> Glycine>
Glycine subgen. Soja.
|
Aromaticity | 0.05 |
Grand average of hydropathy | -1.416 |
Instability index | 26.98 |
Isoelectric point | 9.46 |
Molecular weight | 22072.64 |
Publications | PubMed=20075913
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP29427
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 64.08| 17| 17| 128| 144| 1
---------------------------------------------------------------------------
128- 144 (34.53/11.39) KKHK.KHKDKDKDKDKDR
147- 164 (29.55/ 8.91) KKHKhRHKDRTKDKDKDR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 29.10| 9| 18| 76| 88| 2
---------------------------------------------------------------------------
76- 88 (12.75/17.55) FRDTnariQPFDL
97- 105 (16.35/ 9.41) LRET....APIDL
---------------------------------------------------------------------------
|