<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29426
| Description |
Uncharacterized protein |
| Sequence | MDPEGKKFGGGPRELTGAVDLISHFKLLPHYEFFCKRSLPVSIADTHYLHNVVGDTEIRKGDGMQLEQLIQNTSSFRDTNARIQPFDLDVLKEAFQLRETAPIDLPAAEKGIPTIAGKSKGENKDKEKKHKKHKDKDKDKDKDREHKKHKHRHKDRTKDKDKDRDKKKDKSGHRDSSADHSKKHHEKKRKHDGDDDVNDVHKHKKSKHKSSKIDELGAIKVAG |
| Length | 223 |
| Position | Head |
| Organism | Glycine max (Soybean) (Glycine hispida) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade>
NPAAA clade> indigoferoid/millettioid clade> Phaseoleae> Glycine>
Glycine subgen. Soja.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -1.457 |
| Instability index | 28.91 |
| Isoelectric point | 9.52 |
| Molecular weight | 25572.49 |
| Publications | PubMed=20075913
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
transcription factor binding GO:0008134 IBA:GO_Central
|
| GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP29426
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 58.06| 15| 15| 125| 139| 1
---------------------------------------------------------------------------
125- 139 (29.32/10.10) DKEKKHKKHKDKDKD
141- 155 (28.75/ 9.75) DKDREHKKHKHRHKD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 47.27| 13| 15| 179| 191| 2
---------------------------------------------------------------------------
179- 191 (24.71/ 8.56) DHSKKHHEKKRKH
196- 208 (22.56/ 7.21) DVNDVHKHKKSKH
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 35.08| 11| 18| 76| 88| 3
---------------------------------------------------------------------------
76- 88 (15.78/15.29) FRDTNAriQPFDL
95- 105 (19.29/11.22) FQLRET..APIDL
---------------------------------------------------------------------------
|