<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29417

Description Uncharacterized protein
SequenceMKESYLPELNEMYQKIATQLQQHNSLPTQPKLDQLEKMNVFKMLERIIAFLQVSKSNISPNFKEKLGSYENHIINFINRKRHKKAMPPMQSRQLPLPHIDWQEEVYQKIKSMKENYLPELNEMYQKSASKLQRHTSLPQQPKSYKLEKLKKFMKMLECAIAFLQVSKSNMSPNYRLKLDSCEKQIIKIININRPKKIVPPLQYGQFPPPHMQSH
Length214
PositionTail
OrganismGlycine max (Soybean) (Glycine hispida)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade> NPAAA clade> indigoferoid/millettioid clade> Phaseoleae> Glycine> Glycine subgen. Soja.
Aromaticity0.08
Grand average of hydropathy-0.786
Instability index64.78
Isoelectric point9.80
Molecular weight25435.64
Publications
PubMed=20075913

Function

Annotated function 
GO - Cellular Component
GO - Biological Function
chromatin DNA binding	GO:0031490	IEA:InterPro
transcription coactivator activity	GO:0003713	IEA:InterPro

GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP29417
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             4|     157.44|      27|      28|       6|      32|       1
---------------------------------------------------------------------------
    6-   32 (51.30/31.76)	LPELN..EMYQ.KIA.TQLQQHNSLPT.QPKL
   35-   62 (32.96/17.90)	LEKMNvfKMLE.RII.AFLQVSKS.NI.SPNF
  117-  143 (48.48/29.62)	LPELN..EMYQ.KSA.SKLQRHTSLPQ.QPKS
  149-  178 (24.69/11.65)	LKKFM..KMLEcAIAfLQVSKSNMSPNyRLKL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     130.86|      33|     109|      68|     100|       2
---------------------------------------------------------------------------
   68-  100 (65.03/34.81)	SYENHIINFINRKRHKKAMPPMQSRQLPLPHID
  180-  212 (65.83/35.31)	SCEKQIIKIININRPKKIVPPLQYGQFPPPHMQ
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP29417 with Med15 domain of Kingdom Viridiplantae
Unable to open file!