<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29395
| Description |
Uncharacterized protein |
| Sequence | MRMNKGSLDYWRNYFGAANSDIFGIIDHAIMVAASDCPKEFRLRRDGIAERLFSCRLSRCLGCERVELAVPVDDDDDGGGEGCKSGFDGDGDEFKFEAGASKESKVNSARDYPGEMNTNQVSNYSYGEAEALTDEIEKESQYVEEVFRIKDIFLNYEEESDSVLFDSLRRLQLMELTVDLLKATEIGKAVNPLRKHGSRDICQLARTLIDGWKQMVDEWVKDTTAIAGSEGTPDSVNPSVVDDEEGLPSPPMDEGALFAAPTGSMELSQFFDGMDDDGSELALQFLMLSLDSFCSMVLYLNSPLLTFMIMLGDCCFRSSTQWGIHQEP |
| Length | 328 |
| Position | Unknown |
| Organism | Glycine max (Soybean) (Glycine hispida) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade>
NPAAA clade> indigoferoid/millettioid clade> Phaseoleae> Glycine>
Glycine subgen. Soja.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.347 |
| Instability index | 36.95 |
| Isoelectric point | 4.30 |
| Molecular weight | 36500.43 |
| Publications | PubMed=20075913
|
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP29395
No repeats found
|