Description | Mediator of RNA polymerase II transcription subunit 10 |
Sequence | MDIAAANSSAAAAAAAAASASGNGVQGSAGGERPEDASKQNLAQVTGSIQKTLGLLHQLNLNVSSFSSASQLPLLQRLNALVAELDTMQKLADGCNIQVPMEVVNLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKSLRKHLLEELEQAFPEDVEAYRQIRATSAADSKRLAQSQSSLPNGDAKVKTEH |
Length | 192 |
Position | Middle |
Organism | Brachypodium distachyon (Purple false brome) (Trachynia distachya) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade> Pooideae> Brachypodieae> Brachypodium. |
Aromaticity | 0.03 |
Grand average of hydropathy | -0.355 |
Instability index | 33.47 |
Isoelectric point | 5.40 |
Molecular weight | 20271.42 |
Publications | PubMed=20148030 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364146 |
GO - Cellular Component | chromatin GO:0000785 IBA:GO_Central mediator complex GO:0016592 IBA:GO_Central |
GO - Biological Function | transcription coregulator activity GO:0003712 IBA:GO_Central |
GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IBA:GO_Central |
Binary Interactions |
Repeats | >MDP29385 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 44.31| 13| 16| 48| 63| 1 --------------------------------------------------------------------------- 48- 60 (22.36/18.20) SIQKTLGLLHQLN 67- 79 (21.95/ 8.86) SSASQLPLLQRLN --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 36.84| 11| 20| 105| 116| 2 --------------------------------------------------------------------------- 105- 116 (16.46/13.91) NLIDDGKNpDEF 128- 138 (20.37/11.41) NQITKGKT.DAF --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) MDIAAANSSAAAAAAAAASAS 2) QAFPEDVEAYRQIRA | 1 151 | 21 165 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab