<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29380
Description |
Uncharacterized protein |
Sequence | MDPDGKKFGTGPRELTGAVDLISQYKLQPHHDFFCKRPLPLAISDTHYLHNVVGDTEIRKGEGMELDQLIQNAYLRDKPAYIQPFDMETLGQAFQLRETAPVDLPSAEKGVPTISGKSKSESKDKEKKHKKHKDRDKDKEHKKHKHRHKDRSKDKDKDKDKKKDKSGHHEKKRKHEGMEDSVDLHKHKKSKHKSSKIDEMGNGLS |
Length | 205 |
Position | Head |
Organism | Brachypodium distachyon (Purple false brome) (Trachynia distachya) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Pooideae> Brachypodieae> Brachypodium.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -1.477 |
Instability index | 34.27 |
Isoelectric point | 9.44 |
Molecular weight | 23623.46 |
Publications | PubMed=20148030
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
transcription factor binding GO:0008134 IBA:GO_Central
|
GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IBA:GO_Central
|
Interaction
Repeat regions
Repeats |
>MDP29380
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
4| 110.62| 19| 19| 131| 149| 1
---------------------------------------------------------------------------
119- 138 (27.81/ 8.80) KSESKDK..EKKHkKHKDRDKD
139- 158 (28.55/ 9.23) KEHKKHK..HRHKdRSKDKDKD
159- 179 (25.56/ 7.51) KDKKKDKsgHHEK.KRKHEGME
180- 198 (28.71/ 9.31) DSVDLHK..HKKS.KHKSSKID
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 48.96| 15| 19| 69| 87| 2
---------------------------------------------------------------------------
69- 87 (22.96/26.42) LIQNAYLRDKPayiqPFDM
90- 104 (26.01/17.43) LGQAFQLRETA....PVDL
---------------------------------------------------------------------------
|