<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29377
| Description |
Uncharacterized protein |
| Sequence | MAANFWASSHSKQLLDPEEMDEVPAADRARGITPMEFRLVKIHMSFHIWRLAQQVKVRQRVIATAITYFRRVYTRKSMTEYDPRLVAPACLYLASKVEESTVQARLLVFYIKKMCGSDDKYRFEIKDILEMEMKLLEALDYYLVVYHPYRPLLQLLQDAGITDLTQFAWGLVNDTYKMDLILIYPPYMIALACIYIASVLKDKDTTSWFEELRVDMNIVKSISMVILDFYDTYKIDPQRGLPEDKIIPVMNKLPSKV |
| Length | 257 |
| Position | Kinase |
| Organism | Brachypodium distachyon (Purple false brome) (Trachynia distachya) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Pooideae> Brachypodieae> Brachypodium.
|
| Aromaticity | 0.11 |
| Grand average of hydropathy | -0.038 |
| Instability index | 43.81 |
| Isoelectric point | 6.91 |
| Molecular weight | 30073.98 |
| Publications | PubMed=20148030
|
Function
| Annotated function |
|
| GO - Cellular Component | integral component of membrane GO:0016021 IEA:UniProtKB-KW
mediator complex GO:0016592 IBA:GO_Central
nucleus GO:0005634 IBA:GO_Central
|
| GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IBA:GO_Central
|
| GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IBA:GO_Central
regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP29377
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 35.82| 10| 21| 60| 69| 1
---------------------------------------------------------------------------
60- 69 (17.35/12.03) RVIATAITYF
84- 93 (18.46/13.22) RLVAPACLYL
---------------------------------------------------------------------------
|