<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29370
Description |
Uncharacterized protein |
Sequence | MDIISQLQEQLNEMAMVAVNTFGTLQRDAPPVRLSTSYPDPLNPNPSPEDPAAPAPGAAAASPAPAVPAPPPQPQPALDLAEQPKAMSHALVLAAKKFDALVAALPLSSEDDQMKRIEELQAENEVLGLELQKQLEAAELELRRVETLFNEATDNCINLKKPD |
Length | 163 |
Position | Middle |
Organism | Brachypodium distachyon (Purple false brome) (Trachynia distachya) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Pooideae> Brachypodieae> Brachypodium.
|
Aromaticity | 0.02 |
Grand average of hydropathy | -0.334 |
Instability index | 75.59 |
Isoelectric point | 4.37 |
Molecular weight | 17489.66 |
Publications | PubMed=20148030
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU366036
|
GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
polar nucleus GO:0043078 IEA:EnsemblPlants
|
GO - Biological Function | transcription coregulator activity GO:0003712 IBA:GO_Central
|
GO - Biological Process | defense response to fungus GO:0050832 IEA:EnsemblPlants
regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
Repeats |
>MDP29370
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 70.29| 24| 27| 107| 130| 4
---------------------------------------------------------------------------
107- 130 (37.71/28.54) LSSEDDQMKRIEEL..QAENEVLGLE
135- 160 (32.58/23.76) LEAAELELRRVETLfnEATDNCINLK
---------------------------------------------------------------------------
|