<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29360
| Description |
Uncharacterized protein |
| Sequence | MSKAGGGGGAAAGPTAAAAAAAAQKQRALLQKADADVASLVDNFSALINIARVNDPPVRNTQEAFQMEMRASRMVHSADSLLKLVSELKRTAIFSGLASLNENVDRRIEVLSQQAEGTDKMLEKIGQEAAASLKELEAHYYSSVVRTPLYD |
| Length | 151 |
| Position | Head |
| Organism | Brachypodium distachyon (Purple false brome) (Trachynia distachya) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Pooideae> Brachypodieae> Brachypodium.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.186 |
| Instability index | 40.84 |
| Isoelectric point | 6.13 |
| Molecular weight | 16015.94 |
| Publications | PubMed=20148030
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP29360
No repeats found
No repeats found
|