<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29343
| Description |
Uncharacterized protein |
| Sequence | MQAIQLDPNTYQELETLRNKLWSLQETFATHITYLKEPKYPFTWPDLLNKFNMLTAKFASLSEDFYRYTEKASTATLPKLMLHPYIPTTTEQETNILSVLLRTKLIPDIEKLEAETQAAIARDLVEPQQEGISNTTRIDDEQLIKTQLDQWTELRSRHDRLAVDAAQFVAELSNDHKSNFLLRYEDQIEEEEEEEEEEQDWEKMGFPNEEIWKKWKLECLMNFYSSGKSEVVGSDLKKLATAVKK |
| Length | 245 |
| Position | Head |
| Organism | Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) (Mucormycosis agent) (Rhizopus arrhizus var. delemar) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Fungi incertae sedis> Mucoromycota> Mucoromycotina>
Mucoromycetes> Mucorales> Mucorineae> Rhizopodaceae> Rhizopus.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.700 |
| Instability index | 56.46 |
| Isoelectric point | 4.74 |
| Molecular weight | 28758.05 |
| Publications | PubMed=19578406
|
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP29343
No repeats found
|