<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29339
Description |
Uncharacterized protein |
Sequence | MARMFTNSIYYVHEKSSMAELNKEIPVSQPKVQADDPQVFKENMHELVSDLVKKAKEIDSLIEVLPGIQQTEEEQVK |
Length | 77 |
Position | Middle |
Organism | Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) (Mucormycosis agent) (Rhizopus arrhizus var. delemar) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Fungi incertae sedis> Mucoromycota> Mucoromycotina>
Mucoromycetes> Mucorales> Mucorineae> Rhizopodaceae> Rhizopus.
|
Aromaticity | 0.05 |
Grand average of hydropathy | -0.555 |
Instability index | 59.09 |
Isoelectric point | 4.90 |
Molecular weight | 8861.03 |
Publications | PubMed=19578406
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP29339
No repeats found
No repeats found
|