<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29337
| Description |
Mediator of RNA polymerase II transcription subunit 10 |
| Sequence | MKTLQLTVKNILFAEISYVEHGRNPDIFTQSFVERTATENQYTNGKVKAVDEFKQLLTEEFTKSFPDLYNYENSIDADINSNN |
| Length | 83 |
| Position | Middle |
| Organism | Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) (Mucormycosis agent) (Rhizopus arrhizus var. delemar) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Fungi incertae sedis> Mucoromycota> Mucoromycotina>
Mucoromycetes> Mucorales> Mucorineae> Rhizopodaceae> Rhizopus.
|
| Aromaticity | 0.12 |
| Grand average of hydropathy | -0.641 |
| Instability index | 24.28 |
| Isoelectric point | 4.67 |
| Molecular weight | 9628.53 |
| Publications | PubMed=19578406
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP29337
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 48.93| 13| 31| 28| 40| 1
---------------------------------------------------------------------------
28- 40 (23.26/14.38) FTQSFVERTATEN
61- 73 (25.66/16.42) FTKSFPDLYNYEN
---------------------------------------------------------------------------
|