Description | Mediator of RNA polymerase II transcription subunit 10 |
Sequence | MKTLQLTVKNILFAEISYVEHGRNPDIFTQSFVERTATENQYTNGKVKAVDEFKQLLTEEFTKSFPDLYNYENSIDADINSNN |
Length | 83 |
Position | Middle |
Organism | Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) (Mucormycosis agent) (Rhizopus arrhizus var. delemar) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Fungi incertae sedis> Mucoromycota> Mucoromycotina> Mucoromycetes> Mucorales> Mucorineae> Rhizopodaceae> Rhizopus. |
Aromaticity | 0.12 |
Grand average of hydropathy | -0.641 |
Instability index | 24.28 |
Isoelectric point | 4.67 |
Molecular weight | 9628.53 |
Publications | PubMed=19578406 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364146 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP29337 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 48.93| 13| 31| 28| 40| 1 --------------------------------------------------------------------------- 28- 40 (23.26/14.38) FTQSFVERTATEN 61- 73 (25.66/16.42) FTKSFPDLYNYEN --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) FTQSFVERTAT 2) YTNGKVKAVDEFKQLLTEEFTKSFPDLYNYENSIDADINS | 28 42 | 38 81 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab