<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29314
| Description |
Mediator of RNA polymerase II transcription subunit 15 |
| Sequence | MDVSGQETDWRSTAFRQKLVSQIEDAMRKAGVAHSKSSKEMESHVFLKAKTRDEYLSLVARLIIHFRDIHNKKSQASVSAQLQLQQVALQQQQQQQQQQQQQQFQQQAALQQQQQQQQFQAQQSAMQQQFQAVVQQQQQQLQQQQQQQQHLIKLHHQNQQQIQQQQQQLQRMAQLQLQQQQQQQQQQQQQQQQALQAQPPIQQPPMQQPQPPPSQALPQQLQQMHHPQHHQPPPQPQQPPVAQNQPSQLPPQSQTQPLVSQAQALPGQMLYTQPPLKFVRAPMVVQQPQVQPQVQQQTAVQTAQTAQMVAPGVQVSQSSLPMLSSPSPGQQVQTPQSMPPPPQPSPQPGQPGSQPNSNVSSGPAPSPSSFLPSPSPQPSQSPVTARTPQNFSVPSPGPLNTPVNPSSVMSPAGSSQAEEQQYLDKLKQLSKYIEPLRRMINKIDKNEDRKKDLSKMKSLLDILTDPSKRCPLKTLQKCEIALEKLKNDMAVPTPPPPPVPPTKQQYLCQPLLDAVLANIRSPVFNHSLYRTFVPAMTAIHGPPITAPVVCTRKRRLEDDERQSIPSVLQGEVARLDPKFLVNLDPSHCSNNGTVHLICKLDDKDLPSVPPLELSVPADYPAQSPLWIDRQWQYDANPFLQSVHRCMTSRLLQLPDKHSVTALLNTWAQSVHQACLSAA |
| Length | 678 |
| Position | Tail |
| Organism | Callithrix jacchus (White-tufted-ear marmoset) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Primates> Haplorrhini> Platyrrhini> Cebidae>
Callitrichinae> Callithrix> Callithrix.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.821 |
| Instability index | 92.65 |
| Isoelectric point | 9.38 |
| Molecular weight | 76113.34 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP29314
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 208.05| 41| 41| 112| 152| 1
---------------------------------------------------------------------------
112- 152 (81.13/15.70) QQQQQQQFQAQQSAMQQQFQAVVQQQQQQLQQQQQQQQHLI
202- 232 (60.52/ 9.55) QQPPMQQPQPPPS...QAL.......PQQLQQMHHPQHHQP
237- 276 (66.40/11.31) QQPPVAQNQPSQLPPQSQTQPLVSQA.QALPGQMLYTQPPL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 99.65| 25| 90| 64| 107| 2
---------------------------------------------------------------------------
80- 106 (48.08/27.30) AQLQLQQvaLQQQQQQQQQQQQQQFQQ
173- 197 (51.57/ 9.28) AQLQLQQ..QQQQQQQQQQQQQQALQA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 74.28| 23| 28| 328| 351| 3
---------------------------------------------------------------------------
328- 351 (44.10/16.50) PGQQVQTPQSMPPPPqPSPQP.......GQP
481- 510 (30.18/ 6.34) ALEKLKNDMAVPTPP.PPPVPptkqqylCQP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 87.82| 18| 139| 386| 403| 4
---------------------------------------------------------------------------
363- 381 (30.20/ 9.03) PA..PSPSSFlPSPSPQPSQS
382- 401 (27.63/ 7.58) PVtaRTPQNF.SVPSPGPLNT
606- 623 (29.99/ 8.92) PS..VPPLEL.SVPADYPAQS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 45.52| 14| 150| 438| 453| 5
---------------------------------------------------------------------------
438- 451 (23.13/18.93) RMINKIDKNEDRKK
455- 468 (22.40/10.23) KMKSLLDILTDPSK
---------------------------------------------------------------------------
|