<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29314

Description Mediator of RNA polymerase II transcription subunit 15
SequenceMDVSGQETDWRSTAFRQKLVSQIEDAMRKAGVAHSKSSKEMESHVFLKAKTRDEYLSLVARLIIHFRDIHNKKSQASVSAQLQLQQVALQQQQQQQQQQQQQQFQQQAALQQQQQQQQFQAQQSAMQQQFQAVVQQQQQQLQQQQQQQQHLIKLHHQNQQQIQQQQQQLQRMAQLQLQQQQQQQQQQQQQQQQALQAQPPIQQPPMQQPQPPPSQALPQQLQQMHHPQHHQPPPQPQQPPVAQNQPSQLPPQSQTQPLVSQAQALPGQMLYTQPPLKFVRAPMVVQQPQVQPQVQQQTAVQTAQTAQMVAPGVQVSQSSLPMLSSPSPGQQVQTPQSMPPPPQPSPQPGQPGSQPNSNVSSGPAPSPSSFLPSPSPQPSQSPVTARTPQNFSVPSPGPLNTPVNPSSVMSPAGSSQAEEQQYLDKLKQLSKYIEPLRRMINKIDKNEDRKKDLSKMKSLLDILTDPSKRCPLKTLQKCEIALEKLKNDMAVPTPPPPPVPPTKQQYLCQPLLDAVLANIRSPVFNHSLYRTFVPAMTAIHGPPITAPVVCTRKRRLEDDERQSIPSVLQGEVARLDPKFLVNLDPSHCSNNGTVHLICKLDDKDLPSVPPLELSVPADYPAQSPLWIDRQWQYDANPFLQSVHRCMTSRLLQLPDKHSVTALLNTWAQSVHQACLSAA
Length678
PositionTail
OrganismCallithrix jacchus (White-tufted-ear marmoset)
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Euarchontoglires> Primates> Haplorrhini> Platyrrhini> Cebidae> Callitrichinae> Callithrix> Callithrix.
Aromaticity0.04
Grand average of hydropathy-0.821
Instability index92.65
Isoelectric point9.38
Molecular weight76113.34
Publications









Function






Annotated function

Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors. 


ECO:0000256	RuleBase:RU364148

GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP29314
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     208.05|      41|      41|     112|     152|       1
---------------------------------------------------------------------------
  112-  152 (81.13/15.70)	QQQQQQQFQAQQSAMQQQFQAVVQQQQQQLQQQQQQQQHLI
  202-  232 (60.52/ 9.55)	QQPPMQQPQPPPS...QAL.......PQQLQQMHHPQHHQP
  237-  276 (66.40/11.31)	QQPPVAQNQPSQLPPQSQTQPLVSQA.QALPGQMLYTQPPL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      99.65|      25|      90|      64|     107|       2
---------------------------------------------------------------------------
   80-  106 (48.08/27.30)	AQLQLQQvaLQQQQQQQQQQQQQQFQQ
  173-  197 (51.57/ 9.28)	AQLQLQQ..QQQQQQQQQQQQQQALQA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      74.28|      23|      28|     328|     351|       3
---------------------------------------------------------------------------
  328-  351 (44.10/16.50)	PGQQVQTPQSMPPPPqPSPQP.......GQP
  481-  510 (30.18/ 6.34)	ALEKLKNDMAVPTPP.PPPVPptkqqylCQP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      87.82|      18|     139|     386|     403|       4
---------------------------------------------------------------------------
  363-  381 (30.20/ 9.03)	PA..PSPSSFlPSPSPQPSQS
  382-  401 (27.63/ 7.58)	PVtaRTPQNF.SVPSPGPLNT
  606-  623 (29.99/ 8.92)	PS..VPPLEL.SVPADYPAQS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      45.52|      14|     150|     438|     453|       5
---------------------------------------------------------------------------
  438-  451 (23.13/18.93)	RMINKIDKNEDRKK
  455-  468 (22.40/10.23)	KMKSLLDILTDPSK
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP29314 with Med15 domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) QQQQQQALQAQPPIQQPPMQQPQPPPSQALPQQLQQMHHPQHHQPPPQPQQPPVAQNQPSQLPPQSQTQPLVSQAQALPGQMLYTQPPLKFVRAPMVVQQPQVQPQVQQQTAVQTAQTAQMVAPGVQVSQSSLPMLSSPSPGQQVQTPQSMPPPPQPSPQPGQPGSQPNSNVSSGPAPSPSSFLPSPSPQPSQSPVTARTPQNFSVPSPGPLNTPVNPSSVMSPAGSSQAEEQQYLDKLKQ
188
428










Molecular Recognition Features






MoRF SequenceStartStop




1) LKFVRA
276
281