<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29308
Description |
Uncharacterized protein |
Sequence | MADRLTQLQDTINQQAENFCNSIGILQQFSLPSKFPGFERGGSQTPQQPQSQEDYAVLFAALISRCAKDIDTLIESLPSEESSTELQVQSLRRLEAENKEAAEQLEEVVRQGEILLEKIQGALSDIAQCQLDMQNPALILNKDVKPQL |
Length | 148 |
Position | Middle |
Organism | Bombyx mori (Silk moth) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Lepidoptera> Glossata> Ditrysia> Bombycoidea>
Bombycidae> Bombycinae> Bombyx.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.438 |
Instability index | 69.13 |
Isoelectric point | 4.36 |
Molecular weight | 16502.36 |
Publications | PubMed=19121390
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU366036
|
GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP29308
No repeats found
|