<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29304
| Description |
Mediator of RNA polymerase II transcription subunit 29 |
| Sequence | MHVPMNQVAGAPNVAMQMPVPGPIMQQQSPQQMQPAPVPQQTQQDKMDNISKVKSLMGSLRESIPMTLKSAAQILHQNHNADSNTQKGMDNPVPRFEKNLEEFFSICDQMELHLRTATTCIQQAQSAAHYLPLSVIASRLDSGPTTQETTLSYPQYLKTVGLQISYAKDIHDTLVAAAQNISPTE |
| Length | 185 |
| Position | Tail |
| Organism | Bombyx mori (Silk moth) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Lepidoptera> Glossata> Ditrysia> Bombycoidea>
Bombycidae> Bombycinae> Bombyx.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.454 |
| Instability index | 63.62 |
| Isoelectric point | 6.04 |
| Molecular weight | 20394.02 |
| Publications | PubMed=19121390
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP29304
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 37.23| 11| 17| 1| 13| 2
---------------------------------------------------------------------------
1- 13 (18.81/10.83) MHVP...MNQvaGAPN
18- 31 (18.42/ 6.03) MPVPgpiMQQ..QSPQ
---------------------------------------------------------------------------
|