<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29293
Description |
Uncharacterized protein |
Sequence | MNQTINVEQLNSALNSLRTLRSSVSHVFETLSNGLRADHGEDGKEKFLLELQELLNNVNINLRDLEQTVSGLPIPTAPLNLGNTTYLSQETSQDRQTLYTQLVNSYKWTDKIHEYSSFAHTLLSQNSLKRSYINSGSTKRRGKLQSNHNVAPIQVDNVINNIDRSYNDMKITISRPFASNAVVQINLSHVLKAVVAFKGLLMEWVMVKGYGETLDLWTESRHHVFRKVTENAHAAMLHFYSPTLPELAVRSFMTWLHSYVNLFSEPCKRCSCHLHHTSLLPPAWRDFRTLETFHDECKQ |
Length | 299 |
Position | Tail |
Organism | Bombyx mori (Silk moth) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Lepidoptera> Glossata> Ditrysia> Bombycoidea>
Bombycidae> Bombycinae> Bombyx.
|
Aromaticity | 0.08 |
Grand average of hydropathy | -0.407 |
Instability index | 45.76 |
Isoelectric point | 8.30 |
Molecular weight | 34265.42 |
Publications | PubMed=19121390
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP29293
No repeats found
|