<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29290
| Description |
Uncharacterized protein |
| Sequence | MMPGRIGNISLANENPLGLSWHDSAWIPLLNPSNIMDYFSERSNPFFDRTCNNEIVKMQRLSMDQLQNMTGLEYILLHVQEPILYVVRKQHRHSPTQATPLADYYVIAGIVYQAPDLASVLNSRLLSAVHHLQCSFEETMSYSRYHPSKGYWWDFKPTKPGLGSYNSSQTAPKDVSSTPKEEPSTLFQRQRVDMLLAELVRQFPLPVTQTAPNQANGVTVKTEVSNDKNEKGMEGNLNNITIKQEPVDPTTSEMTNGSMQGQIEIKTEIKQENMKPPPEKKPRNL |
| Length | 285 |
| Position | Head |
| Organism | Bombyx mori (Silk moth) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Lepidoptera> Glossata> Ditrysia> Bombycoidea>
Bombycidae> Bombycinae> Bombyx.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.625 |
| Instability index | 44.88 |
| Isoelectric point | 6.39 |
| Molecular weight | 32346.34 |
| Publications | PubMed=19121390
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP29290
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 73.52| 25| 42| 206| 231| 2
---------------------------------------------------------------------------
206- 231 (38.46/29.86) PVTQTAPN.QANG.VTVKTEVSNDkNEK
249- 275 (35.07/22.17) PTTSEMTNgSMQGqIEIKTEIKQE.NMK
---------------------------------------------------------------------------
|