Description | Uncharacterized protein |
Sequence | MMPGRIGNISLANENPLGLSWHDSAWIPLLNPSNIMDYFSERSNPFFDRTCNNEIVKMQRLSMDQLQNMTGLEYILLHVQEPILYVVRKQHRHSPTQATPLADYYVIAGIVYQAPDLASVLNSRLLSAVHHLQCSFEETMSYSRYHPSKGYWWDFKPTKPGLGSYNSSQTAPKDVSSTPKEEPSTLFQRQRVDMLLAELVRQFPLPVTQTAPNQANGVTVKTEVSNDKNEKGMEGNLNNITIKQEPVDPTTSEMTNGSMQGQIEIKTEIKQENMKPPPEKKPRNL |
Length | 285 |
Position | Head |
Organism | Bombyx mori (Silk moth) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota> Neoptera> Endopterygota> Lepidoptera> Glossata> Ditrysia> Bombycoidea> Bombycidae> Bombycinae> Bombyx. |
Aromaticity | 0.07 |
Grand average of hydropathy | -0.625 |
Instability index | 44.88 |
Isoelectric point | 6.39 |
Molecular weight | 32346.34 |
Publications | PubMed=19121390 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364143 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP29290 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 73.52| 25| 42| 206| 231| 2 --------------------------------------------------------------------------- 206- 231 (38.46/29.86) PVTQTAPN.QANG.VTVKTEVSNDkNEK 249- 275 (35.07/22.17) PTTSEMTNgSMQGqIEIKTEIKQE.NMK --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) MQGQIEIKTEIKQENMKPPPEKKPRNL 2) WWDFK | 259 152 | 285 156 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab