<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29286
| Description |
Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MMSDQFRKVEPYSPKSSPRGARSPVVSRQDSSGTLKTTISLGKNPSIVHSGPFYLMKEPPGECELTGATNLMAYYGLVHSYSKFNGKKLKESLSSFLPNLPGIVDGPGQDDNSTLSSVIAKRPIGGKELLPLTSAQLAGFRLHPGPLPEQYRYVSATPPKRHKSKHKKHKHKDGAPPGQETPLQDSSNPDTYEKKHKKQKRHDDEKERKKRKKEKKRKKQKHSPEHGGLTPNQHPLP |
| Length | 237 |
| Position | Head |
| Organism | Bombyx mori (Silk moth) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Lepidoptera> Glossata> Ditrysia> Bombycoidea>
Bombycidae> Bombycinae> Bombyx.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -1.172 |
| Instability index | 55.86 |
| Isoelectric point | 9.98 |
| Molecular weight | 26434.81 |
| Publications | PubMed=19121390
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP29286
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 107.07| 23| 48| 160| 184| 1
---------------------------------------------------------------------------
160- 182 (45.26/19.03) KRHK.SKHKKHKH...KDGAPPGQETP
190- 208 (28.76/10.12) DTYE.KKHKKQKR...HDD...EKER.
210- 235 (33.05/11.35) KRKKeKKRKKQKHspeHGGLTPNQH.P
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 85.20| 22| 38| 86| 107| 2
---------------------------------------------------------------------------
86- 107 (38.86/26.71) GKKLKESLSSFLPNLPG..IVDGP
108- 123 (18.49/ 8.79) GQDDNSTLSSVIAKRP........
126- 146 (27.85/17.03) GKELLPLTSA...QLAGfrLHPGP
---------------------------------------------------------------------------
|