<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29284
Description |
Uncharacterized protein |
Sequence | MAGQGHQFPSNFQANAAGMRSGFGGGPMGAQMQTMPNQLAGVMGGPMGNTGGMVGMGNQMVPPYGAIQNQMGNMGIGPQPPNGTQHGENASNDKKAKMQEQLRTIRLLFKRLRLIYEKCNETCQGMEYTHMESLIPLKDEAENKTLDERRNTESYRLALEENTELTEQVY |
Length | 170 |
Position | Head |
Organism | Bombyx mori (Silk moth) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Lepidoptera> Glossata> Ditrysia> Bombycoidea>
Bombycidae> Bombycinae> Bombyx.
|
Aromaticity | 0.05 |
Grand average of hydropathy | -0.748 |
Instability index | 30.17 |
Isoelectric point | 5.93 |
Molecular weight | 18658.96 |
Publications | PubMed=19121390
|
Function
Annotated function |
|
GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP29284
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 62.20| 18| 18| 22| 39| 1
---------------------------------------------------------------------------
1- 27 (28.19/10.27) MAGQGHQFPSNFqanaagmrsGFGGGP
28- 46 (34.01/13.77) MGAQMQTMPNQL........aGVMGGP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 37.64| 9| 17| 55| 65| 2
---------------------------------------------------------------------------
55- 65 (16.68/12.14) GMGNQmvPPYG
75- 83 (20.96/ 9.08) GIGPQ..PPNG
---------------------------------------------------------------------------
|