<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29279
| Description |
Uncharacterized protein |
| Sequence | LGGLQASPSAHPDTLFSPTDRSMSSSLSASQLHAVSMRDPLNRVLANLFLLISSILGSKTAGTHTQFVQWFMEECVDCLEQGSHGSILQFMPFTMVSELVKVSTMSSPKIVLAITDLGLPLGRRVAAKAIAAL |
| Length | 133 |
| Position | Tail |
| Organism | Meleagris gallopavo (Wild turkey) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Archelosauria> Archosauria> Dinosauria> Saurischia> Theropoda>
Coelurosauria> Aves> Neognathae> Galloanserae> Galliformes> Phasianidae>
Meleagridinae> Meleagris.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | 0.341 |
| Instability index | 56.57 |
| Isoelectric point | 7.08 |
| Molecular weight | 14185.35 |
| Publications | PubMed=20838655
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP29279
No repeats found
No repeats found
|