<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29277

Description Uncharacterized protein
SequenceGSTIDQEYGPAYTPQTHTPFGMPPSSAPPSNSGPGILPSPSTPRFPTPRTPRTPRTPRGAGGPASAQGSVKYENSDLYSPASTPSTCRPLNSVEPATVPSIPEAHSLYVNLILSESVMNLFKDCNFDSCCICVCNMNIKGADVGVYIPDPTQEAQYRCTCGFSAVMNRKFGNGSGLFLEDELDILGRNSDCGKEAEKRFEVLRATAVEHSGGSKEADRLPDDLILLLQDQCTNLFSPFGAADQDPLPKVAAVGNMVRAEERDCCNDCYLALEHGRQFMDNMSGGKVDEALVKNTCLHHWSKRNVVDVSMQCSQDILRMLLSLQPVLQDAIQKKKTVRSWGVQGPLTWQQFHKMAGRGSYGTDESPEPLPIPTFLLGYDYDFLVLSPFALPYWERLMLEPYGSQRDIAYVVVCPENEALLNGAKTFFRDLTAIYESCRLGQHRPICKLLPDGIMRVGSAASTKLSEKSVAEWFSQAAHANNESFSRLKLYAQVCRYDLGMVPLFYFPQNCIEIHSCLAFANVEKPKHGSVFGANAFHARILGKPFF
Length545
PositionMiddle
OrganismAnolis carolinensis (Green anole) (American chameleon)
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Lepidosauria> Squamata> Bifurcata> Unidentata> Episquamata> Toxicofera> Iguania> Dactyloidae> Anolis.
Aromaticity0.09
Grand average of hydropathy-0.280
Instability index41.90
Isoelectric point5.99
Molecular weight60024.65
Publications









Function






Annotated function


GO - Cellular Component
mediator complex	GO:0016592	IBA:GO_Central

GO - Biological Function
transcription coregulator activity	GO:0003712	IBA:GO_Central

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IBA:GO_Central









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP29277
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      80.66|      23|      28|     123|     149|       1
---------------------------------------------------------------------------
  127-  149 (46.21/36.43)	DSCCICVCN....MNIK.GADVGVYIPD
  153-  180 (34.45/15.43)	EAQYRCTCGfsavMNRKfGNGSGLFLED
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      91.98|      27|      69|       1|      28|       2
---------------------------------------------------------------------------
    1-   28 (52.17/27.43)	GStIDQE....YGPAYTPQTHTPF.GMPPSSAP
   68-   99 (39.81/16.61)	GS.VKYEnsdlYSPASTPSTCRPLnSVEPATVP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      63.87|      19|     117|     103|     121|       3
---------------------------------------------------------------------------
  103-  121 (33.29/27.64)	EAHSLYVNLI..LSESVMNLF
  215-  235 (30.58/24.73)	EADRLPDDLIllLQDQCTNLF
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP29277 with Med13 domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) GSTIDQEYGPAYTPQTHTPFGMPPSSAPPSNSGPGILPSPSTPRFPTPRTPRTPRTPRGAGGPASAQGSVKYENS
1
75










Molecular Recognition Features






MoRF SequenceStartStop




NANANA