<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29270

Description Uncharacterized protein
SequenceMTPPLSSLSLFPLFALKLQETRLGRLINDVRKKTENEELAKRAKKLLRNWQKLIEPVAQNEAALRGLPNPPGSANGGAHNCRVETPPGAGPKPVPDAKSRNDVQKPHSPKPGTRKRKGGGEPRDGLQGPPSSSSSSSSSLPKATKGSHEAVQNSSPPPTNGIGGSPESFPSPPEEAEGVRAEESGEKPSGKIPINAVRPHTSSPAGLFKPSGLPAMLKTAVLYEKAEDAVATGGQPRSPRCPSFSPRSLRLETFARQHAAFSSSLAVVAAEGPTSSRSPPAPEAAPEAQLFLPGAAASPGGPLPEPFSPGVLRGDSSDGFEGKKKKKSRPKDYAASLDGPGSEGGGGVKPVRLKKERRLTFDPMTGEIKPLAQRDSLLPAASVSVSADLPAFAEQPPLPPVLSPPSPSSSSSQRTVPEAKGLPLHSPFEQTNWKELSRNEIIQSYLTRQSSLLSSSGAQTPGAHYFMSEYLRQEESTRREARKTHVLAPHGKGPSDLPGVTRELTPGDLERIGGRRWPGVNGCYDTQGNWYDWTQCISLDPHGDDGRLNILPYVCLD
Length557
PositionUnknown
OrganismAnolis carolinensis (Green anole) (American chameleon)
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Lepidosauria> Squamata> Bifurcata> Unidentata> Episquamata> Toxicofera> Iguania> Dactyloidae> Anolis.
Aromaticity0.05
Grand average of hydropathy-0.707
Instability index69.63
Isoelectric point9.39
Molecular weight59157.73
Publications

Function

Annotated function
GO - Cellular Component
core mediator complex	GO:0070847	IBA:GO_Central
mediator complex	GO:0016592	IBA:GO_Central
GO - Biological Function
transcription coregulator activity	GO:0003712	IBA:GO_Central
GO - Biological Process
positive regulation of gene expression	GO:0010628	IBA:GO_Central
regulation of transcription by RNA polymerase II	GO:0006357	IBA:GO_Central

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP29270
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     107.21|      35|      42|     402|     442|       2
---------------------------------------------------------------------------
   85-  126 (52.71/14.74)	TPP....GAGPKPVPDAKSrndvqKP.HSPKPGTRKRKGGGEprDGL
  403-  442 (54.50/27.03)	SPPspssSSSQRTVPEAKG.....LPlHSPFEQTNWKELSRN..EII
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      52.89|      16|      19|     278|     294|       3
---------------------------------------------------------------------------
  238-  253 (24.02/ 6.49)	SPRCPSFSPRS.LRLET
  278-  294 (28.86/12.83)	SPPAPEAAPEAqLFLPG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      55.12|      18|      42|     153|     170|       4
---------------------------------------------------------------------------
  129-  146 (26.09/ 8.78)	PPSSSSSSSSSLPKATKG
  147-  164 (29.03/10.66)	SHEAVQNSSPPPTNGIGG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     115.90|      35|      43|     298|     336|       5
---------------------------------------------------------------------------
  298-  333 (58.67/26.26)	SPGGPLPEPFSPGVLRGDSSDGFEGKKKKKSRpKDY
  342-  376 (57.24/24.18)	SEGGGGVKPVRLKKERRLTFDPMTGEIKPLAQ.RDS
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP29270 with Med26 domain of Kingdom Metazoa

Unable to open file!