Description | Mediator of RNA polymerase II transcription subunit 6 |
Sequence | MAAVDIRDNLLGISWVDSAWIPILNSGSVLDYFSERSNPFYDRTCNNEMVKMQRLTLDHLNQMVGVEYILLHAQEPILFIIRKQQRQSPTQVIPLADYYIIAGVIYQAPDLGSVVNSRVLTAVHGIQSAFEEAMSYCRYHPSKGYWWHFKDQEERDKAKPKAKKKEEPSSIFQRHRVDSLLLDLRNKFPPKFVQQKQGEKPIPVDQIKEPEPAPETVKQEEKESAKTTQQSTSTKAPPEKRMRLQ |
Length | 245 |
Position | Head |
Organism | Anolis carolinensis (Green anole) (American chameleon) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Lepidosauria> Squamata> Bifurcata> Unidentata> Episquamata> Toxicofera> Iguania> Dactyloidae> Anolis. |
Aromaticity | 0.09 |
Grand average of hydropathy | -0.644 |
Instability index | 55.27 |
Isoelectric point | 8.69 |
Molecular weight | 28324.04 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 PIRNR:PIRNR023869 |
GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central mediator complex GO:0016592 IBA:GO_Central nucleoplasm GO:0005654 IEA:Ensembl |
GO - Biological Function | transcription coactivator activity GO:0003713 IBA:GO_Central |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central |
Binary Interactions |
Repeats | >MDP29267 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 113.23| 35| 51| 151| 191| 1 --------------------------------------------------------------------------- 151- 191 (54.24/43.87) DQEERDKAKPKAKKKEEPSSIFQRHRVDSllldlrNKFPPK 205- 239 (59.00/35.60) DQIKEPEPAPETVKQEEKESAKTTQQSTS......TKAPPE --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) KPIPVDQIKEPEPAPETVKQEEKESAKTTQQSTSTKAPPEKRMRLQ 2) VDSLLLDLRNKFPPKFVQ | 200 177 | 245 194 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab