<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29266
| Description |
Mediator of RNA polymerase II transcription subunit 9 |
| Sequence | AGPPPLPAPPQQQQAQQPTSQPPQQQQQPSPAEAKFQAPAQPPAQSSAPQASPTAAPPSHEQASFLPLVHDVIKCMDKDSQDVHQMLNELRTKFVEMRKLIKSMQGIGMSPEQQQVQLQNLREQVKTKSELLQKYKSLCMFEIPKE |
| Length | 146 |
| Position | Middle |
| Organism | Anolis carolinensis (Green anole) (American chameleon) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Lepidosauria> Squamata> Bifurcata> Unidentata> Episquamata> Toxicofera>
Iguania> Dactyloidae> Anolis.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.860 |
| Instability index | 91.73 |
| Isoelectric point | 8.01 |
| Molecular weight | 16239.36 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP29266
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 83.17| 24| 30| 7| 36| 1
---------------------------------------------------------------------------
7- 36 (43.58/23.79) PA.PPQQQQAQQ..PTSQPPQQQQqpspaeAKF
39- 65 (39.59/12.32) PAqPPAQSSAPQasPTAAPPSHEQ......ASF
---------------------------------------------------------------------------
|